(data stored in ACNUC9435 zone)

EMBL: CP000904.PE67

CP000904.PE67        Location/Qualifiers
FT   CDS             complement(104060..104278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5503"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909; KEGG:
FT                   btl:BALH_0906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5503"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46491"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV59"
FT                   /protein_id="ABY46491.1"
FT                   /translation="MIQIKVTPEMLEEAANRASNTRITLESIHNNLCNEIDHLCFQWIG
FT                   ASNQQFIQMFNDAKPKAFTSINSLVQV"
     MIQIKVTPEM LEEAANRASN TRITLESIHN NLCNEIDHLC FQWIGASNQQ FIQMFNDAKP        60
     KAFTSINSLV QV                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page