(data stored in ACNUC9435 zone)

EMBL: CP000904.PE68

CP000904.PE68        Location/Qualifiers
FT   CDS             106631..107071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5506"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46492"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV60"
FT                   /protein_id="ABY46492.1"
FT                   /translation="MNLNKLIVSCGVISALTFGVLGNNAYAEEVQKSNDAINVIEHVPT
FT                   DLLLTQTLDYTGEAVTSFVYKGSTDLSFFIKNNGQNKMGYSVKGPNKEPIVGGYIKPGE
FT                   QKINVTNVRNALSPLPVGTYKIYVSNDDGSTGQFQVAVNSLD"
     MNLNKLIVSC GVISALTFGV LGNNAYAEEV QKSNDAINVI EHVPTDLLLT QTLDYTGEAV        60
     TSFVYKGSTD LSFFIKNNGQ NKMGYSVKGP NKEPIVGGYI KPGEQKINVT NVRNALSPLP       120
     VGTYKIYVSN DDGSTGQFQV AVNSLD                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page