(data stored in ACNUC9435 zone)

EMBL: CP000904.PE69

CP000904.PE69        Location/Qualifiers
FT   CDS             107386..108219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5507"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: bce:BC2985
FT                   vancomycin B-type resistance protein VanW"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5507"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46493"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV61"
FT                   /protein_id="ABY46493.1"
FT                   /translation="MNIVNLRPKQRSKYRIMLGTWYYSTKRYIQWLADGKTYAKTLQQE
FT                   KLPCTAIQHRTILLRKLKDVDMWYQQNKVVNLKIAIKQLDGIVIRPGETFSYWRLIGKP
FT                   TRRKGYVEGMILHYGSFQAGIGGGLCQLSNLIYWMTLHTPLTVTERYRHSFDVFPDSKR
FT                   TQPFGSGATCSYNYLDLQIKNETDQSYQLHLYITEKHLVGEWRTAYPQLYQYEVYEKEH
FT                   SIQSAYWGGYIRHNVIQRRVYSQQKQFVEDQYVTENHAIMMYEPLLACNNEESGD"
     MNIVNLRPKQ RSKYRIMLGT WYYSTKRYIQ WLADGKTYAK TLQQEKLPCT AIQHRTILLR        60
     KLKDVDMWYQ QNKVVNLKIA IKQLDGIVIR PGETFSYWRL IGKPTRRKGY VEGMILHYGS       120
     FQAGIGGGLC QLSNLIYWMT LHTPLTVTER YRHSFDVFPD SKRTQPFGSG ATCSYNYLDL       180
     QIKNETDQSY QLHLYITEKH LVGEWRTAYP QLYQYEVYEK EHSIQSAYWG GYIRHNVIQR       240
     RVYSQQKQFV EDQYVTENHA IMMYEPLLAC NNEESGD                                277
//

If you have problems or comments...

PBIL Back to PBIL home page