(data stored in ACNUC9435 zone)

EMBL: CP000904.PE7

CP000904.PE7         Location/Qualifiers
FT   CDS             15649..19167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1879 uncharacterized, phage-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5439"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46431"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ9"
FT                   /protein_id="ABY46431.1"
FT                   /translation="MEKELIFPVPYSEFDRKKDAEYDGDPNGDYVMAEDVNELQESIEK
FT                   IERVINFTELESTVSDELNKKVDKATMSDFGSPLFVGYRGASINAYDSIEKRINAFSYI
FT                   PHVMINKEESTNFDFFVNEVKKSGTLLYGIINYSDVILNNIEANITWFQSKGFHGVLLP
FT                   GFGFENGWNRSQQNQILQYIHARGMVAVITGEIDTTLFNKPHKNNPQQADLKTSKDDIY
FT                   LAQDVFVLNGAKNNPIVIPSVVFNLNKAQKERGIQIFVEDTADASSDNNKLYLYGKMLS
FT                   TLYNLDGYSLVPKSRYALNEKVERYLHGFELGKWKTQNPIYVEEATATSRSFSKGSILF
FT                   DKVKNECYIKGVGLNPSIYTWQDKQIPGNAIDFASAIYGSEGVKTLVDAINNNDHKIHY
FT                   SKIDGMEEGGVTPDLFKDTVIRAINNSPAAVAKNPPKGYDELAGNNFIHGGVIDYIDAG
FT                   SIKSGILNIDAIKTNIIEAINAYIGTAKINTAVIGELSADHIAANVIDAINIYATNISS
FT                   SSAKINTAVIGELSSDHIKGAVIEAVNLYAGEAVIDSAKIGQLDADHIKATVIEAINAS
FT                   IETAVIDSAKIGTLTASHIKGMVVEAINLYAGQAKIDAAQIGALKADNISAGLIEALEI
FT                   SAGSADFDRLQASVIDAINASIEHAFIDGAIIGEGTVDSAQIADGSITDAKIVSLVANK
FT                   IVAGTIDTGQVTLQGTNGHLRITGNRLQVFDNQKTPIERVSIGDVNADGTLYGLRVRGA
FT                   DGVTVLYDEKGVYSEGITDGAITNPKIQEGAVDGGKHIAANTVTADKLVAEAITTRELA
FT                   AKSVNANHLQVGAIVAGSGVIGEAAIGEAEIAQASITDAHIKKLSADSVSAGSLQIQSR
FT                   NLVSNSTLRKGLLDWTTDPILDIAEVSEVVRLNTTNSMHLFTTGKQTQNLSAYSKFVPA
FT                   SPGENYSASVYVLTKNILNYDGGHPRVEIEYFNDSARISSKNTAAQLTSNDLWQRISIT
FT                   EVAPAETTRVRLRIYHPKNGDSYFCRPMLQKGNIITEWTGDGSYMTEDGFYTGDLHAKQ
FT                   IKVGKIKAEMLQIGPDTEFEPGYSPGELREEMKDRIPYRVEILSTNGIAFKGGNISTTL
FT                   KANVYLGAENVTDQMDAIRFKWMRVGRNGEDDLVWNAAHKGLKEVPITRDDVYQRATFL
FT                   CEVLDS"
     MEKELIFPVP YSEFDRKKDA EYDGDPNGDY VMAEDVNELQ ESIEKIERVI NFTELESTVS        60
     DELNKKVDKA TMSDFGSPLF VGYRGASINA YDSIEKRINA FSYIPHVMIN KEESTNFDFF       120
     VNEVKKSGTL LYGIINYSDV ILNNIEANIT WFQSKGFHGV LLPGFGFENG WNRSQQNQIL       180
     QYIHARGMVA VITGEIDTTL FNKPHKNNPQ QADLKTSKDD IYLAQDVFVL NGAKNNPIVI       240
     PSVVFNLNKA QKERGIQIFV EDTADASSDN NKLYLYGKML STLYNLDGYS LVPKSRYALN       300
     EKVERYLHGF ELGKWKTQNP IYVEEATATS RSFSKGSILF DKVKNECYIK GVGLNPSIYT       360
     WQDKQIPGNA IDFASAIYGS EGVKTLVDAI NNNDHKIHYS KIDGMEEGGV TPDLFKDTVI       420
     RAINNSPAAV AKNPPKGYDE LAGNNFIHGG VIDYIDAGSI KSGILNIDAI KTNIIEAINA       480
     YIGTAKINTA VIGELSADHI AANVIDAINI YATNISSSSA KINTAVIGEL SSDHIKGAVI       540
     EAVNLYAGEA VIDSAKIGQL DADHIKATVI EAINASIETA VIDSAKIGTL TASHIKGMVV       600
     EAINLYAGQA KIDAAQIGAL KADNISAGLI EALEISAGSA DFDRLQASVI DAINASIEHA       660
     FIDGAIIGEG TVDSAQIADG SITDAKIVSL VANKIVAGTI DTGQVTLQGT NGHLRITGNR       720
     LQVFDNQKTP IERVSIGDVN ADGTLYGLRV RGADGVTVLY DEKGVYSEGI TDGAITNPKI       780
     QEGAVDGGKH IAANTVTADK LVAEAITTRE LAAKSVNANH LQVGAIVAGS GVIGEAAIGE       840
     AEIAQASITD AHIKKLSADS VSAGSLQIQS RNLVSNSTLR KGLLDWTTDP ILDIAEVSEV       900
     VRLNTTNSMH LFTTGKQTQN LSAYSKFVPA SPGENYSASV YVLTKNILNY DGGHPRVEIE       960
     YFNDSARISS KNTAAQLTSN DLWQRISITE VAPAETTRVR LRIYHPKNGD SYFCRPMLQK      1020
     GNIITEWTGD GSYMTEDGFY TGDLHAKQIK VGKIKAEMLQ IGPDTEFEPG YSPGELREEM      1080
     KDRIPYRVEI LSTNGIAFKG GNISTTLKAN VYLGAENVTD QMDAIRFKWM RVGRNGEDDL      1140
     VWNAAHKGLK EVPITRDDVY QRATFLCEVL DS                                    1172
//

If you have problems or comments...

PBIL Back to PBIL home page