(data stored in ACNUC9435 zone)

EMBL: CP000904.PE70

CP000904.PE70        Location/Qualifiers
FT   CDS             complement(108739..109089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5508"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cps:CPS_1684 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5508"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46494"
FT                   /db_xref="GOA:A9VV62"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV62"
FT                   /protein_id="ABY46494.1"
FT                   /translation="MKLGHIMIFVNDMTKARWFYSELLGLKTLLEQENKLVFALDGCQL
FT                   IAFKCEKTKEIGDYSNEARTVLVFEVVSVEQTYKELKEKGIQFLHDKPTQGRYAAFVDP
FT                   FGNVHEIAESFG"
     MKLGHIMIFV NDMTKARWFY SELLGLKTLL EQENKLVFAL DGCQLIAFKC EKTKEIGDYS        60
     NEARTVLVFE VVSVEQTYKE LKEKGIQFLH DKPTQGRYAA FVDPFGNVHE IAESFG           116
//

If you have problems or comments...

PBIL Back to PBIL home page