(data stored in ACNUC9435 zone)

EMBL: CP000904.PE71

CP000904.PE71        Location/Qualifiers
FT   CDS             109525..110193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5509"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5509"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46495"
FT                   /db_xref="GOA:A9VV63"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV63"
FT                   /protein_id="ABY46495.1"
FT                   /translation="MNRQNSFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   AHTTIMRWVHQYSPELDKRVRRYLKKTKDSWRGDETYVKVKGKWMYLYRAVDSEGNTID
FT                   FYLSKNRNAKSAKRFLKKALASCHSVTPRVITVDKNLAYPVAIKALHEEKSMPIGVKLR
FT                   QIRYLNNIVEQDHRFIKKRIRTMLSLKSFRTAKWILAGIEAMHMMKKDKPLKRSLSKIK
FT                   "
     MNRQNSFKWK HYQPDIILLT VRWYLRYNLS FRDLVEMMEE RGLSIAHTTI MRWVHQYSPE        60
     LDKRVRRYLK KTKDSWRGDE TYVKVKGKWM YLYRAVDSEG NTIDFYLSKN RNAKSAKRFL       120
     KKALASCHSV TPRVITVDKN LAYPVAIKAL HEEKSMPIGV KLRQIRYLNN IVEQDHRFIK       180
     KRIRTMLSLK SFRTAKWILA GIEAMHMMKK DKPLKRSLSK IK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page