(data stored in ACNUC9435 zone)

EMBL: CP000904.PE72

CP000904.PE72        Location/Qualifiers
FT   CDS             110443..112608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BXA0164 protective antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5510"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46496"
FT                   /db_xref="GOA:A9VV64"
FT                   /db_xref="InterPro:IPR035088"
FT                   /db_xref="InterPro:IPR037149"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV64"
FT                   /protein_id="ABY46496.1"
FT                   /translation="MKKLKPALSVLGSVSMALTLAYPALADIKQPNAGSTIEMFKEDAN
FT                   AKEGKDLIYGTDGKKGKMSTEKIEIQNNDWDQDGISNDLEIRGYKIEFNRQTGKNEAQA
FT                   WDPERDKDKLKFITNPMSANSDGDPFTDAYEVQYYGSNSDTEFNPMVANIPNLQVGIKR
FT                   IGVTPLAAITDSNGGSIDKGWEKSVSTQHSFGVGAGVEGGVEGSAAGPVPSGKASLNVS
FT                   YGYSKTSTDTERYSSNIDWSTAKTVDSAKAAKVSLQLEYKNTGTASAQNVSPHFNIRLG
FT                   DKIISTVKATQDRYKANQLSTEKGGRNTTEVLIDSVDNQADVNIYLSLDELKAVEQGAI
FT                   LSVEVLPTSTMELYIEKDGEFMNLGDSGKFESRVNASTTILETDIGNKPKFRMYAPEGV
FT                   GSDTNLTFNEVLKHVKVDSTKINEFIDNSRGDQVIVAKENLENAKKSYVSKGAKVGVFT
FT                   KIQQPELSYSAYDPFTKKFYAAVVPGLFGASNEVSVSFENKKSKQTQQVTLLRKGNVYE
FT                   SKEAVSLNDFNPSQKVTFEINDAQKKLPIQKISTVVTYNKEYENYLTHRFSDELIVEGT
FT                   PYTMKASGNPVLSYKGNDKWQYLAYAGNYTQPVNVIIERKGQPKPGQPIKKGEDIHIKV
FT                   QNSAYSGYEYLKLQNGYIHFDQKQNASTFKFNHIHSPGSLDYQREWNLQSDGNNIGLDK
FT                   GGSGYVTYGNDVHTGSSLNRWSFDKAK"
     MKKLKPALSV LGSVSMALTL AYPALADIKQ PNAGSTIEMF KEDANAKEGK DLIYGTDGKK        60
     GKMSTEKIEI QNNDWDQDGI SNDLEIRGYK IEFNRQTGKN EAQAWDPERD KDKLKFITNP       120
     MSANSDGDPF TDAYEVQYYG SNSDTEFNPM VANIPNLQVG IKRIGVTPLA AITDSNGGSI       180
     DKGWEKSVST QHSFGVGAGV EGGVEGSAAG PVPSGKASLN VSYGYSKTST DTERYSSNID       240
     WSTAKTVDSA KAAKVSLQLE YKNTGTASAQ NVSPHFNIRL GDKIISTVKA TQDRYKANQL       300
     STEKGGRNTT EVLIDSVDNQ ADVNIYLSLD ELKAVEQGAI LSVEVLPTST MELYIEKDGE       360
     FMNLGDSGKF ESRVNASTTI LETDIGNKPK FRMYAPEGVG SDTNLTFNEV LKHVKVDSTK       420
     INEFIDNSRG DQVIVAKENL ENAKKSYVSK GAKVGVFTKI QQPELSYSAY DPFTKKFYAA       480
     VVPGLFGASN EVSVSFENKK SKQTQQVTLL RKGNVYESKE AVSLNDFNPS QKVTFEINDA       540
     QKKLPIQKIS TVVTYNKEYE NYLTHRFSDE LIVEGTPYTM KASGNPVLSY KGNDKWQYLA       600
     YAGNYTQPVN VIIERKGQPK PGQPIKKGED IHIKVQNSAY SGYEYLKLQN GYIHFDQKQN       660
     ASTFKFNHIH SPGSLDYQRE WNLQSDGNNI GLDKGGSGYV TYGNDVHTGS SLNRWSFDKA       720
     K                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page