(data stored in ACNUC9435 zone)

EMBL: CP000904.PE73

CP000904.PE73        Location/Qualifiers
FT   CDS             113459..114169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5511"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pth:PTH_0245 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5511"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46497"
FT                   /db_xref="GOA:A9VV65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV65"
FT                   /protein_id="ABY46497.1"
FT                   /translation="MKKILIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDVFLTHQ
FT                   PDLIILDLMMPKKDGWELCGEIRQQSNVPIIMLTAKGEERDRILGLTMGADDYLTKPFS
FT                   PRELVLRVQIILRRGNQVAIQAKESLSEVIEFPDLKIYPKTRCVLVCENEVELTVKEFE
FT                   VLYVMAKHPKQVFSRSQLLELIWDFGHEGASNTVTVLVSRLREKLEKHTIKNHWIHTVW
FT                   GIGYRFEPNGRNES"
     MKKILIVEDE ENIREVCKRY LEREEYEVYT AVNGTEGWDV FLTHQPDLII LDLMMPKKDG        60
     WELCGEIRQQ SNVPIIMLTA KGEERDRILG LTMGADDYLT KPFSPRELVL RVQIILRRGN       120
     QVAIQAKESL SEVIEFPDLK IYPKTRCVLV CENEVELTVK EFEVLYVMAK HPKQVFSRSQ       180
     LLELIWDFGH EGASNTVTVL VSRLREKLEK HTIKNHWIHT VWGIGYRFEP NGRNES           236
//

If you have problems or comments...

PBIL Back to PBIL home page