(data stored in ACNUC9435 zone)

EMBL: CP000904.PE74

CP000904.PE74        Location/Qualifiers
FT   CDS             114166..115245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ssa:SSA_1114 histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5512"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46498"
FT                   /db_xref="GOA:A9VV66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV66"
FT                   /protein_id="ABY46498.1"
FT                   /translation="MRLRIQLLLMNLLSTSILVIAIWYSETKMLLEPEQTRLLTVIAVV
FT                   GLIISTFIYWLMTRPIMRSIKNLMTLTKQFSDRQFETMYIIGKEPREFKELATSFQQMA
FT                   KKLEEGFTQLEEGEKARKELITNISHDLRTPMASIQLMIEALQDNLIEDPEMRKQYLAT
FT                   ILKEIERLSGLINDLFELSKLEFEQVDFYPSFTHIDKVLLDVLESHSVLLEDKQIDLQL
FT                   QVPDRLPRLLIMPCKIARVIGNLLDNAIRYSPVSGTIELIVEENKQNQQVQFILRDEGE
FT                   GISPNDQLRVFERFFRTDQSRSSQSGGSGLGLAIAKSLIEMHKGEIGVRDRADGKQGSE
FT                   FWFTLPITSEKNKTAERLL"
     MRLRIQLLLM NLLSTSILVI AIWYSETKML LEPEQTRLLT VIAVVGLIIS TFIYWLMTRP        60
     IMRSIKNLMT LTKQFSDRQF ETMYIIGKEP REFKELATSF QQMAKKLEEG FTQLEEGEKA       120
     RKELITNISH DLRTPMASIQ LMIEALQDNL IEDPEMRKQY LATILKEIER LSGLINDLFE       180
     LSKLEFEQVD FYPSFTHIDK VLLDVLESHS VLLEDKQIDL QLQVPDRLPR LLIMPCKIAR       240
     VIGNLLDNAI RYSPVSGTIE LIVEENKQNQ QVQFILRDEG EGISPNDQLR VFERFFRTDQ       300
     SRSSQSGGSG LGLAIAKSLI EMHKGEIGVR DRADGKQGSE FWFTLPITSE KNKTAERLL        359
//

If you have problems or comments...

PBIL Back to PBIL home page