(data stored in ACNUC9435 zone)

EMBL: CP000904.PE75

CP000904.PE75        Location/Qualifiers
FT   CDS             115323..115826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5513"
FT                   /product="secreted protein"
FT                   /note="KEGG: sco:SCO0153 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5513"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46499"
FT                   /db_xref="GOA:A9VV67"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV67"
FT                   /protein_id="ABY46499.1"
FT                   /translation="MKRKYVWLIGGSIILVLILWSLFRPEKLFIDKKVNETLPQTEMQS
FT                   MKTKQVQDQVQVISAGQFQNGVHETTGTATIHQLADGKRILRLSNFSTSNGPDVRVVLV
FT                   PTDRLKNNEDVKNHQYIELGKLKGNKGNQNYEIPEGIDVSTYGSVSVWCKRFNENFGAA
FT                   YFKK"
     MKRKYVWLIG GSIILVLILW SLFRPEKLFI DKKVNETLPQ TEMQSMKTKQ VQDQVQVISA        60
     GQFQNGVHET TGTATIHQLA DGKRILRLSN FSTSNGPDVR VVLVPTDRLK NNEDVKNHQY       120
     IELGKLKGNK GNQNYEIPEG IDVSTYGSVS VWCKRFNENF GAAYFKK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page