(data stored in ACNUC9435 zone)

EMBL: CP000904.PE76

CP000904.PE76        Location/Qualifiers
FT   CDS             116476..117219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5515"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: NHL repeat containing protein; Collagen triple
FT                   helix repeat; KEGG: btl:BALH_p0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5515"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46500"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR021201"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV68"
FT                   /protein_id="ABY46500.1"
FT                   /translation="MFLGGGYMERKNKWYGLNSNVNLSASSFDPNLVGPTLPPISPISV
FT                   PTGPTGETGITGPTGPTGPTGPTGVTGITGPTGPTGATGITGPTGPTGETGITGPTGPG
FT                   PTVSLKFLYVANFNENTVEIYDIFNPIFPVRIGEFNGGNLANPAGLAITGTTLYVTNNG
FT                   DNTVEIYDILNPIAPVHVGEFNGGNLSEPDGLAITGTTLYVANFNDNTVEIYDILNPIA
FT                   PVRVGEFNAGNLSSPAGLIIFSLFG"
     MFLGGGYMER KNKWYGLNSN VNLSASSFDP NLVGPTLPPI SPISVPTGPT GETGITGPTG        60
     PTGPTGPTGV TGITGPTGPT GATGITGPTG PTGETGITGP TGPGPTVSLK FLYVANFNEN       120
     TVEIYDIFNP IFPVRIGEFN GGNLANPAGL AITGTTLYVT NNGDNTVEIY DILNPIAPVH       180
     VGEFNGGNLS EPDGLAITGT TLYVANFNDN TVEIYDILNP IAPVRVGEFN AGNLSSPAGL       240
     IIFSLFG                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page