(data stored in ACNUC9435 zone)

EMBL: CP000904.PE77

CP000904.PE77        Location/Qualifiers
FT   CDS             118528..120342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5518"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: dsy:DSY1105
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5518"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46501"
FT                   /db_xref="GOA:A9VV69"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV69"
FT                   /protein_id="ABY46501.1"
FT                   /translation="MPEPLKKNSRYMVGLDSLRGLAILGVILYHINFNWMPGGFLGVTV
FT                   FFVLSGYLITDILAIEWKNNKRIDLKKFWLSRARRLLPGMLIMLIVTLAWITIFHSSLL
FT                   VKMRGDSLAALLYFSNWWYIYHKLSYFDSFSQLSPLNHFWSLAVEEQFYVVWPFVISLG
FT                   FYYIKKQSRMILFICLGAIASALAMAILYEPGTDPSRIYYGTDTRAFSLLIGAALALIW
FT                   PSSRLASKIIPQARLILDIIGGVALIIILTMFWKTNQYEPFLYRGGMVLLSIATALLVA
FT                   NLAHPASRIAQFLRFRPLRWMGVRSYGIYLLHYPIITLTTPKVNTGEFSFTRAILQFLL
FT                   IIIVAQISWKFIENPIRKGALKNIRIKNLKIRNLTLSGKLVLICAVFISSIATFGLTTA
FT                   SKAKENTQKDKVEAVQEEQAKHPVAVWEKPADEPPQNKEEQKEENPAQPKDPLTVTAVG
FT                   DSIMIDIAPYLKNTFPNIRIDAKIGRQMSQAIPAVEQLKNEGNLGSNVIIGLGTNGAFT
FT                   KEQLASLIEVIGNERKIILINTRVPRPWESLVNEKLKEAASSYKNVVLVDWYSASAGNK
FT                   AYFEPDGVHLTKIGAEAYAALVAKEVNQ"
     MPEPLKKNSR YMVGLDSLRG LAILGVILYH INFNWMPGGF LGVTVFFVLS GYLITDILAI        60
     EWKNNKRIDL KKFWLSRARR LLPGMLIMLI VTLAWITIFH SSLLVKMRGD SLAALLYFSN       120
     WWYIYHKLSY FDSFSQLSPL NHFWSLAVEE QFYVVWPFVI SLGFYYIKKQ SRMILFICLG       180
     AIASALAMAI LYEPGTDPSR IYYGTDTRAF SLLIGAALAL IWPSSRLASK IIPQARLILD       240
     IIGGVALIII LTMFWKTNQY EPFLYRGGMV LLSIATALLV ANLAHPASRI AQFLRFRPLR       300
     WMGVRSYGIY LLHYPIITLT TPKVNTGEFS FTRAILQFLL IIIVAQISWK FIENPIRKGA       360
     LKNIRIKNLK IRNLTLSGKL VLICAVFISS IATFGLTTAS KAKENTQKDK VEAVQEEQAK       420
     HPVAVWEKPA DEPPQNKEEQ KEENPAQPKD PLTVTAVGDS IMIDIAPYLK NTFPNIRIDA       480
     KIGRQMSQAI PAVEQLKNEG NLGSNVIIGL GTNGAFTKEQ LASLIEVIGN ERKIILINTR       540
     VPRPWESLVN EKLKEAASSY KNVVLVDWYS ASAGNKAYFE PDGVHLTKIG AEAYAALVAK       600
     EVNQ                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page