(data stored in ACNUC9435 zone)

EMBL: CP000904.PE78

CP000904.PE78        Location/Qualifiers
FT   CDS             complement(120529..121224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_2236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5519"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46502"
FT                   /db_xref="GOA:A9VV70"
FT                   /db_xref="InterPro:IPR039286"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV70"
FT                   /protein_id="ABY46502.1"
FT                   /translation="MSEQCPINVPCQVDGQTQTPLSDAAATPILTPGAPIVKIPVVLAE
FT                   RTIQIVVESDISLDPPAVEIKRILKNVFLTQCKLVPVAFTPIPGTNYRQVTRAKLFVQG
FT                   YIRKNIEYASDDCNGVLYDRIANVPFSGFADLTAADFLSLAIVASSSDTTSHFINPKNG
FT                   DLPRLDKYFFENTVFYNEQPYCELVSAQFFELDFSPCPTDLNEPFDTLREKIVLDLTLK
FT                   VLQVQQVQV"
     MSEQCPINVP CQVDGQTQTP LSDAAATPIL TPGAPIVKIP VVLAERTIQI VVESDISLDP        60
     PAVEIKRILK NVFLTQCKLV PVAFTPIPGT NYRQVTRAKL FVQGYIRKNI EYASDDCNGV       120
     LYDRIANVPF SGFADLTAAD FLSLAIVASS SDTTSHFINP KNGDLPRLDK YFFENTVFYN       180
     EQPYCELVSA QFFELDFSPC PTDLNEPFDT LREKIVLDLT LKVLQVQQVQ V                231
//

If you have problems or comments...

PBIL Back to PBIL home page