(data stored in ACNUC9435 zone)

EMBL: CP000904.PE79

CP000904.PE79        Location/Qualifiers
FT   CDS             123514..123708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5521"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46503"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV71"
FT                   /protein_id="ABY46503.1"
FT                   /translation="MEGIKVPYLQTPTGYFVKVSVTIKGQTERGTRIAQGVIAPVKTAS
FT                   FVEVGGQRGENGFGSIGVK"
     MEGIKVPYLQ TPTGYFVKVS VTIKGQTERG TRIAQGVIAP VKTASFVEVG GQRGENGFGS        60
     IGVK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page