(data stored in ACNUC9435 zone)

EMBL: CP000904.PE8

CP000904.PE8         Location/Qualifiers
FT   CDS             19253..21001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lla:L21300 prophage pi3 protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5440"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46432"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV00"
FT                   /protein_id="ABY46432.1"
FT                   /translation="MAKTLATGMISIVDFNDAPSLSAFVSTTSPKTQIYDPASGTYTPN
FT                   WTSAGPTLTPSLFISTEGTTDAISSAKAVKWYDSIDTSKVIVTGGAYTVTGNTLKISQN
FT                   IMTGSTYAKTFIAEIIWTDPTTLADLVVRAEFTFSRADNGKTGASAISAVLSNDSDVIP
FT                   TDSAGNNGNFTGAISTMTIFEGATDVSASWTVAANPVDITGTLSGKTYTVTGFVAGKDT
FT                   GYVDLTASKSGYASVTRRFALSKSKQGISGTTPTLYRLLSSADAIQKNLAGVYTPTTII
FT                   FTAKSQTGSGAYGDYSGKFTIEETTDGTTFTNKYTSASNEPSKIHTPSAGIKAIRVRLH
FT                   IAGVTPNGSNHIDEQTISVVSDGATGVSGADAVLVSVWAPNGNLFKNDLSTSLTAQADL
FT                   YKGATVQSSGVTYEWFVQKSGNADEGAGTGWDKIDATNQASYGVTGAVNTATITVTAAG
FT                   ITNLAAFKIKATYSSKAYYDTIIFYDQTDPIMVSVESSNGNIFKNGSVSSQILCRLFQN
FT                   GEEIDPKLASATTGYKYTYTWTKLKMDGTQDMDFGGKAISTKTGKWIDITDADIFQKAV
FT                   FKVEIS"
     MAKTLATGMI SIVDFNDAPS LSAFVSTTSP KTQIYDPASG TYTPNWTSAG PTLTPSLFIS        60
     TEGTTDAISS AKAVKWYDSI DTSKVIVTGG AYTVTGNTLK ISQNIMTGST YAKTFIAEII       120
     WTDPTTLADL VVRAEFTFSR ADNGKTGASA ISAVLSNDSD VIPTDSAGNN GNFTGAISTM       180
     TIFEGATDVS ASWTVAANPV DITGTLSGKT YTVTGFVAGK DTGYVDLTAS KSGYASVTRR       240
     FALSKSKQGI SGTTPTLYRL LSSADAIQKN LAGVYTPTTI IFTAKSQTGS GAYGDYSGKF       300
     TIEETTDGTT FTNKYTSASN EPSKIHTPSA GIKAIRVRLH IAGVTPNGSN HIDEQTISVV       360
     SDGATGVSGA DAVLVSVWAP NGNLFKNDLS TSLTAQADLY KGATVQSSGV TYEWFVQKSG       420
     NADEGAGTGW DKIDATNQAS YGVTGAVNTA TITVTAAGIT NLAAFKIKAT YSSKAYYDTI       480
     IFYDQTDPIM VSVESSNGNI FKNGSVSSQI LCRLFQNGEE IDPKLASATT GYKYTYTWTK       540
     LKMDGTQDMD FGGKAISTKT GKWIDITDAD IFQKAVFKVE IS                          582
//

If you have problems or comments...

PBIL Back to PBIL home page