(data stored in ACNUC9435 zone)

EMBL: CP000904.PE80

CP000904.PE80        Location/Qualifiers
FT   CDS             complement(123766..123978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA2025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5522"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46504"
FT                   /db_xref="GOA:A9VV72"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV72"
FT                   /protein_id="ABY46504.1"
FT                   /translation="MSETIIICLYIVFGISAVLGLIKELKKPKKNQFLILFESLILIGA
FT                   IFLVVSDHFCRIPCVVSYMINSILV"
     MSETIIICLY IVFGISAVLG LIKELKKPKK NQFLILFESL ILIGAIFLVV SDHFCRIPCV        60
     VSYMINSILV                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page