(data stored in ACNUC9435 zone)

EMBL: CP000904.PE83

CP000904.PE83        Location/Qualifiers
FT   CDS             complement(125825..125989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BA_4279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5525"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46507"
FT                   /db_xref="GOA:A9VV75"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV75"
FT                   /protein_id="ABY46507.1"
FT                   /translation="MTDTIRIVLFTLVGISAVFSVIKEFQKPEKRKFWITFETLILIGA
FT                   AWMLIGLLM"
     MTDTIRIVLF TLVGISAVFS VIKEFQKPEK RKFWITFETL ILIGAAWMLI GLLM              54
//

If you have problems or comments...

PBIL Back to PBIL home page