(data stored in ACNUC9435 zone)

EMBL: CP000904.PE84

CP000904.PE84        Location/Qualifiers
FT   CDS             126091..126720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5526"
FT                   /product="Recombination protein U"
FT                   /note="PFAM: Recombination protein U; KEGG: btl:BALH_p0007
FT                   recombination protein U (penicillin-binding protein-related
FT                   factor A)"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5526"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46508"
FT                   /db_xref="GOA:A9VV76"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV76"
FT                   /protein_id="ABY46508.1"
FT                   /translation="MGQGNRGMAFEKLINLVNEMYQRGGVALINKRPTPVKVLKSKGGR
FT                   VLNGFYEAKSTVDYDGVYKGRAIAFEAKSTENPTRFDLKNIAQHQLDYLEKAEKMGAIC
FT                   FFLIEFSKGKSVFVIPLAVIQSYVRMSQQPKGKKSIPRADFDIYGYLVEQTERAPVDYL
FT                   QYVDEAVSPVMFDGMIQFDQDHKKVANNIEAAKEKMNNKKHKLLKA"
     MGQGNRGMAF EKLINLVNEM YQRGGVALIN KRPTPVKVLK SKGGRVLNGF YEAKSTVDYD        60
     GVYKGRAIAF EAKSTENPTR FDLKNIAQHQ LDYLEKAEKM GAICFFLIEF SKGKSVFVIP       120
     LAVIQSYVRM SQQPKGKKSI PRADFDIYGY LVEQTERAPV DYLQYVDEAV SPVMFDGMIQ       180
     FDQDHKKVAN NIEAAKEKMN NKKHKLLKA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page