(data stored in ACNUC9435 zone)

EMBL: CP000904.PE85

CP000904.PE85        Location/Qualifiers
FT   CDS             126858..127226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5527"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="TIGRFAM: phage transcriptional regulator, ArpU
FT                   family; KEGG: bcz:pE33L466_0182 possible prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5527"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46509"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV77"
FT                   /protein_id="ABY46509.1"
FT                   /translation="MEQLTLLPAIDDKKVQKEVVSILKEYRALKMRFNNEVEQEGISLF
FT                   PELRNSKTMSQFKVRQIEKVLDDILDDDERSIISMKFLTNKSVKDSFVQNELMISNSYF
FT                   YAKKKSAIKLVATALGII"
     MEQLTLLPAI DDKKVQKEVV SILKEYRALK MRFNNEVEQE GISLFPELRN SKTMSQFKVR        60
     QIEKVLDDIL DDDERSIISM KFLTNKSVKD SFVQNELMIS NSYFYAKKKS AIKLVATALG       120
     II                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page