(data stored in ACNUC9435 zone)

EMBL: CP000904.PE86

CP000904.PE86        Location/Qualifiers
FT   CDS             128085..128357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_3118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5528"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46510"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV78"
FT                   /protein_id="ABY46510.1"
FT                   /translation="MKIKFDVVKNENFDFTLLETRLLKTFKEVDSEAIIEKVEDKIFEK
FT                   NDMQTHLVEITINVTGKNIGYRSVSASIFIVLESLSIKLFNISIH"
     MKIKFDVVKN ENFDFTLLET RLLKTFKEVD SEAIIEKVED KIFEKNDMQT HLVEITINVT        60
     GKNIGYRSVS ASIFIVLESL SIKLFNISIH                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page