(data stored in ACNUC9435 zone)

EMBL: CP000904.PE87

CP000904.PE87        Location/Qualifiers
FT   CDS             129069..129431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5529"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bca:BCE_2526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5529"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46511"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV79"
FT                   /protein_id="ABY46511.1"
FT                   /translation="MKKIFALFAILTVFAVFSFGCDIRSLKLYGKDKYYVQIKGEGEIK
FT                   DKTRVYTLPAYDEEGAEKKISFTSHKAENDKKLKEDAFLRLYVSEDNDKSVDVKSYEEV
FT                   KKEDLPEKVKKKLNVK"
     MKKIFALFAI LTVFAVFSFG CDIRSLKLYG KDKYYVQIKG EGEIKDKTRV YTLPAYDEEG        60
     AEKKISFTSH KAENDKKLKE DAFLRLYVSE DNDKSVDVKS YEEVKKEDLP EKVKKKLNVK       120
//

If you have problems or comments...

PBIL Back to PBIL home page