(data stored in ACNUC9435 zone)

EMBL: CP000904.PE88

CP000904.PE88        Location/Qualifiers
FT   CDS             130743..131816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5530"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bcz:pE33L466_0018
FT                   tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5530"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46512"
FT                   /db_xref="GOA:A9VV80"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV80"
FT                   /protein_id="ABY46512.1"
FT                   /translation="MDYSKQRQKSVHRKKLYENLNEMPFYIEEFVEYKELHDASPSTLL
FT                   NYVYDFRVFFNWLLSEQIIEFKPIKDISFSDLENLKKKDVENFMRFLKLQQNMQNSSVN
FT                   RKISALKSLFKYLTSLSENDDGECYFYRNVMAKIEIHKDKETLNARAKRMRSKIFHNDD
FT                   DQEFLNYIKYEHEKSLTKHQLFYFLRDKDRDVAILSLFLGSGIRVSELADLRMEDINLK
FT                   ERLIDVIRKGNKEDSVWITPIALNDLEKYMEIRDKKYAPGKELKNVFLSKYKHTAQPLS
FT                   VRAIQDIVEKYTKAFGKRMSPHKLRHTLANKLYMEEKDSLQVMQQLGHTSQDTALLYTQ
FT                   LGETTIKDSLGRIGKNK"
     MDYSKQRQKS VHRKKLYENL NEMPFYIEEF VEYKELHDAS PSTLLNYVYD FRVFFNWLLS        60
     EQIIEFKPIK DISFSDLENL KKKDVENFMR FLKLQQNMQN SSVNRKISAL KSLFKYLTSL       120
     SENDDGECYF YRNVMAKIEI HKDKETLNAR AKRMRSKIFH NDDDQEFLNY IKYEHEKSLT       180
     KHQLFYFLRD KDRDVAILSL FLGSGIRVSE LADLRMEDIN LKERLIDVIR KGNKEDSVWI       240
     TPIALNDLEK YMEIRDKKYA PGKELKNVFL SKYKHTAQPL SVRAIQDIVE KYTKAFGKRM       300
     SPHKLRHTLA NKLYMEEKDS LQVMQQLGHT SQDTALLYTQ LGETTIKDSL GRIGKNK          357
//

If you have problems or comments...

PBIL Back to PBIL home page