(data stored in ACNUC9435 zone)

EMBL: CP000904.PE89

CP000904.PE89        Location/Qualifiers
FT   CDS             complement(132101..133078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5531"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46513"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV81"
FT                   /protein_id="ABY46513.1"
FT                   /translation="MDYKMIAKIYNINVTATLNKGKLIDDQNMRLSNSLATFNRFFNNE
FT                   AFTHAIGFLEFESLQNSIYMYQSGGLKQLQETFKSHSIKGEANYYYINSFLRKIDIFMV
FT                   ALWLVKDHSVNIETGFIVTGTNKNVYSVTSSNTAFLSSKSNGLINDTMFTIEEINEAIQ
FT                   YYKLLHPEINPNIGNQIADGLYKVKSLRVPRAFYFLQAARHETDVPVKIMKYCTILECL
FT                   FTTGRDEITHKISERFAKLMSEQLEQREYYFSLVKKSYAIRSTVIHGQSMSEKRYADAL
FT                   ELAIELDNAIRELLLKIILNSDFEKNFEQNEEDLERWFRKLILS"
     MDYKMIAKIY NINVTATLNK GKLIDDQNMR LSNSLATFNR FFNNEAFTHA IGFLEFESLQ        60
     NSIYMYQSGG LKQLQETFKS HSIKGEANYY YINSFLRKID IFMVALWLVK DHSVNIETGF       120
     IVTGTNKNVY SVTSSNTAFL SSKSNGLIND TMFTIEEINE AIQYYKLLHP EINPNIGNQI       180
     ADGLYKVKSL RVPRAFYFLQ AARHETDVPV KIMKYCTILE CLFTTGRDEI THKISERFAK       240
     LMSEQLEQRE YYFSLVKKSY AIRSTVIHGQ SMSEKRYADA LELAIELDNA IRELLLKIIL       300
     NSDFEKNFEQ NEEDLERWFR KLILS                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page