(data stored in ACNUC9435 zone)

EMBL: CP000904.PE9

CP000904.PE9         Location/Qualifiers
FT   CDS             21064..27585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5441"
FT                   /product="Carbohydrate-binding CenC domain protein"
FT                   /note="PFAM: Carbohydrate-binding CenC domain protein;
FT                   KEGG: cpf:CPF_0969 KID repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5441"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46433"
FT                   /db_xref="GOA:A9VV01"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV01"
FT                   /protein_id="ABY46433.1"
FT                   /translation="MKGREYMPYAVGQITIVDLNDAIRSGTAPKNPVDGMLWIDTSVTP
FT                   NILKSWNAVSNKWVEQTLSIGGLDPNFDKDVQNLKKFVTDASNDGIIQTSEKLNVKLLL
FT                   VEITGDILAGTTLPTLATIDTAKGGQVYLARAEARAAGIPITHADYTAFETSYNDLKTY
FT                   LESLSPRPWQTGNTTIVPATWTSKWDLYYDKLTKLAVTTSTYLANSIKPGEDYNGVTIN
FT                   TDKGIVVLRGDNLFRTILNATEGISIEKNNAGTWNKMFYTNLDGKIYANGLVISSDSTI
FT                   AGTDANTIKNNAAAGKAGIDDLTNDLKVTPSEKTTLSREWESIKAEYTQVLAQATSLGV
FT                   TTATYTTSYTNLDGVTPKIAAEVLASMTSTYTFASASTRDAFRAKINTYFTESEKIKKA
FT                   INDAINESANNANDKIDNLKIGSRNIVRKKQVIPINAASTSYDEATNTWTLTANDGAGG
FT                   AWGAGVRITDKFSVIPIGSWYTASFEVYSPVDITWNNDTNNFPIGTSSGTNDNDEVALR
FT                   KNSGRNIKANVWTKCWFSYKNKDNSTTELYDQSNIGIVNNTGAPITFKIRNVKGELGSI
FT                   PTDFTSAPEDVDEMIANISFSGRNLLLDSNTDFSTTGYLINIYKLSEDWIVGQEYTFVI
FT                   KGTVPAGQRLGVWQNGGSNNMGYATTTYVNGVTYVTFKAIAPTSGQERTLSLYNYPSNT
FT                   TLSNVDWVALYKGNKPMDWMIAPEDIESIVKLQSSGAANMFRNSGSFKNLNGWILNAGK
FT                   SLNIAEKDGFTVLEAVGSITSTNHVTRNVLKPSTEYVYSVEIMFSKDTNIDNTKPIHHW
FT                   FFDTGGNYNAVDSYTLISNDKVAKANTWTRVSIVFKTKATITDAAYFKAFVYDNVQLTD
FT                   DNKYWVKNVMFSETNRAVIWSPSLADIEEMVANVSVGGRNIFLNSGLQQGAKYWYSNQS
FT                   QTEIVNDGSEKAFKFITNSGVVNGGIYQRQGGVSTGSLPFEKDQDYTLSVLLKSSVSGQ
FT                   KMDVGAEGISLSLFTIGTEWKEYSFTFKGTGAGNGTIIFYTRSAPDNTQIFVKRMKLEK
FT                   GNKKTDYAAAPEDTDQAISEVKDSVADMTSDMKITPLEKQTLSRDWESIKSEYWQVLPQ
FT                   GQAISSVSTTAYSTAYTNLDSVSPKIASEVLANMNATYSFASTAARDLFRNQINKYSDE
FT                   AEKVKRAIAEATNDANRELAQAISTGKMMFTDPIFKNGANNIIAYNNTSGSAVTATRVS
FT                   KPSDAPTTSSSVMEIKTTGAASPGHGGYVQNFNARSGAKFLVRIIAKIPAGCTLNVASN
FT                   SMGTGYTDKILTSNKGTGKFEEYIRLITCGTTGTFSNGGHFYLTSGLTATPEAPITWQV
FT                   AFATAYDVGDADYTVIDNKDKWDSAANDVKQGQVVINSTFSDWPGSFPNGLGSWSGSTV
FT                   SKETTLTRTGNAMRFNVPADNSQIGTTILPSFFIPNLPNNKYYAVELDFMLVSGAITGA
FT                   CLLLDWNGMSPSRTSIHLSDVESAPVLGKWYTLRAVMKRPTDNVTGYTGLAGFLLANYS
FT                   GSTTNKVKNIVFDRLVFREPTQQEIDAYEITTIENGKTVIDGGKLKTNSVKAESVDARR
FT                   LRVTNNSGLVTLEITDTGEVTVNGKVSINSRTDFAEGFDPSKNDGGRNILLNSRFSTAD
FT                   MTSWTNWGAPSVRQVEDITDLPGFDKAVKFTTTANNQGLNQNVSVINGKTYTLSSYVKS
FT                   ASGQPVLQVYDGAGYPSVVMNSTDVGKNKWVKIYFVFTAKANNVRLDMGKSAGGTLGTY
FT                   WFTGVKLEEGDKSTGWNPANEDIDGLLGKVVAPNGEIKALDIASSMSITPGAIDVISSS
FT                   INLKGKVTFSSFASGWALDSKGNKISNSDQPDYDPKNPLYLDMDGNYRPLTDEKDFMSS
FT                   LFTKDDKTGVTVIDGNYIKTGTIQAKYANFRDVQVYNDQGQQTFRIDTNGNLSTSGTSQ
FT                   SIGYERQKKGWKIDADGSAEFNAATFRGDIELGYYNAPTNAFVVTGGLLSSVGGTGKDL
FT                   RFWAGANKSTAPFKVYSDGTLEATKGYFTGTFSGEVVVGNISIRDTPTKGDAKIILTDD
FT                   SKIQKVVLGESAVELNTKTTFGNFLTVDIDNQKLDFGANDFKIDYTNNTIKMKSFSLKG
FT                   TTALEFISDGSSGDDFVFKNVTGDTSVRVDGSFIARDDIEITNVLRMKKATDTGNKGID
FT                   YVFI"
     MKGREYMPYA VGQITIVDLN DAIRSGTAPK NPVDGMLWID TSVTPNILKS WNAVSNKWVE        60
     QTLSIGGLDP NFDKDVQNLK KFVTDASNDG IIQTSEKLNV KLLLVEITGD ILAGTTLPTL       120
     ATIDTAKGGQ VYLARAEARA AGIPITHADY TAFETSYNDL KTYLESLSPR PWQTGNTTIV       180
     PATWTSKWDL YYDKLTKLAV TTSTYLANSI KPGEDYNGVT INTDKGIVVL RGDNLFRTIL       240
     NATEGISIEK NNAGTWNKMF YTNLDGKIYA NGLVISSDST IAGTDANTIK NNAAAGKAGI       300
     DDLTNDLKVT PSEKTTLSRE WESIKAEYTQ VLAQATSLGV TTATYTTSYT NLDGVTPKIA       360
     AEVLASMTST YTFASASTRD AFRAKINTYF TESEKIKKAI NDAINESANN ANDKIDNLKI       420
     GSRNIVRKKQ VIPINAASTS YDEATNTWTL TANDGAGGAW GAGVRITDKF SVIPIGSWYT       480
     ASFEVYSPVD ITWNNDTNNF PIGTSSGTND NDEVALRKNS GRNIKANVWT KCWFSYKNKD       540
     NSTTELYDQS NIGIVNNTGA PITFKIRNVK GELGSIPTDF TSAPEDVDEM IANISFSGRN       600
     LLLDSNTDFS TTGYLINIYK LSEDWIVGQE YTFVIKGTVP AGQRLGVWQN GGSNNMGYAT       660
     TTYVNGVTYV TFKAIAPTSG QERTLSLYNY PSNTTLSNVD WVALYKGNKP MDWMIAPEDI       720
     ESIVKLQSSG AANMFRNSGS FKNLNGWILN AGKSLNIAEK DGFTVLEAVG SITSTNHVTR       780
     NVLKPSTEYV YSVEIMFSKD TNIDNTKPIH HWFFDTGGNY NAVDSYTLIS NDKVAKANTW       840
     TRVSIVFKTK ATITDAAYFK AFVYDNVQLT DDNKYWVKNV MFSETNRAVI WSPSLADIEE       900
     MVANVSVGGR NIFLNSGLQQ GAKYWYSNQS QTEIVNDGSE KAFKFITNSG VVNGGIYQRQ       960
     GGVSTGSLPF EKDQDYTLSV LLKSSVSGQK MDVGAEGISL SLFTIGTEWK EYSFTFKGTG      1020
     AGNGTIIFYT RSAPDNTQIF VKRMKLEKGN KKTDYAAAPE DTDQAISEVK DSVADMTSDM      1080
     KITPLEKQTL SRDWESIKSE YWQVLPQGQA ISSVSTTAYS TAYTNLDSVS PKIASEVLAN      1140
     MNATYSFAST AARDLFRNQI NKYSDEAEKV KRAIAEATND ANRELAQAIS TGKMMFTDPI      1200
     FKNGANNIIA YNNTSGSAVT ATRVSKPSDA PTTSSSVMEI KTTGAASPGH GGYVQNFNAR      1260
     SGAKFLVRII AKIPAGCTLN VASNSMGTGY TDKILTSNKG TGKFEEYIRL ITCGTTGTFS      1320
     NGGHFYLTSG LTATPEAPIT WQVAFATAYD VGDADYTVID NKDKWDSAAN DVKQGQVVIN      1380
     STFSDWPGSF PNGLGSWSGS TVSKETTLTR TGNAMRFNVP ADNSQIGTTI LPSFFIPNLP      1440
     NNKYYAVELD FMLVSGAITG ACLLLDWNGM SPSRTSIHLS DVESAPVLGK WYTLRAVMKR      1500
     PTDNVTGYTG LAGFLLANYS GSTTNKVKNI VFDRLVFREP TQQEIDAYEI TTIENGKTVI      1560
     DGGKLKTNSV KAESVDARRL RVTNNSGLVT LEITDTGEVT VNGKVSINSR TDFAEGFDPS      1620
     KNDGGRNILL NSRFSTADMT SWTNWGAPSV RQVEDITDLP GFDKAVKFTT TANNQGLNQN      1680
     VSVINGKTYT LSSYVKSASG QPVLQVYDGA GYPSVVMNST DVGKNKWVKI YFVFTAKANN      1740
     VRLDMGKSAG GTLGTYWFTG VKLEEGDKST GWNPANEDID GLLGKVVAPN GEIKALDIAS      1800
     SMSITPGAID VISSSINLKG KVTFSSFASG WALDSKGNKI SNSDQPDYDP KNPLYLDMDG      1860
     NYRPLTDEKD FMSSLFTKDD KTGVTVIDGN YIKTGTIQAK YANFRDVQVY NDQGQQTFRI      1920
     DTNGNLSTSG TSQSIGYERQ KKGWKIDADG SAEFNAATFR GDIELGYYNA PTNAFVVTGG      1980
     LLSSVGGTGK DLRFWAGANK STAPFKVYSD GTLEATKGYF TGTFSGEVVV GNISIRDTPT      2040
     KGDAKIILTD DSKIQKVVLG ESAVELNTKT TFGNFLTVDI DNQKLDFGAN DFKIDYTNNT      2100
     IKMKSFSLKG TTALEFISDG SSGDDFVFKN VTGDTSVRVD GSFIARDDIE ITNVLRMKKA      2160
     TDTGNKGIDY VFI                                                         2173
//

If you have problems or comments...

PBIL Back to PBIL home page