(data stored in ACNUC9435 zone)

EMBL: CP000904.PE90

CP000904.PE90        Location/Qualifiers
FT   CDS             133250..134356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5532"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: baa:BXA0200
FT                   integrase/recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5532"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46514"
FT                   /db_xref="GOA:A9VV82"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV82"
FT                   /protein_id="ABY46514.1"
FT                   /translation="MSNREKQVYQARVERHKEKMPWYIIEYIEEKTNLSPATLYGYLIE
FT                   YEMFLQWLISSRLAVADGEVVTKIHEVPIDTLEHLPLKQVKRFKSYLERQGNKTKAVIR
FT                   TFSALKSLFYYLTSNTEDDNGECYFYRNVMAKMEIHKEKIDAAARAKEISEVIFHNNDD
FT                   IKFMRFLSNEYEQMLQENAPGKLRFFKRDRERDIAILSLILGTGLRVSEAASLTISSVN
FT                   FRTRYIKVVRKGDKKSAILATQTALDDVQEYLKVRAVRYKCPEDEDILFVTNYKGSYAQ
FT                   ISVNAIQKFTEKYTRAFDEKKSPHKLRHTYATNHYNENKDLVLLANQMGHNSMETTSLY
FT                   TNIDDTKRRAAIERLEQRQLEENDEIDT"
     MSNREKQVYQ ARVERHKEKM PWYIIEYIEE KTNLSPATLY GYLIEYEMFL QWLISSRLAV        60
     ADGEVVTKIH EVPIDTLEHL PLKQVKRFKS YLERQGNKTK AVIRTFSALK SLFYYLTSNT       120
     EDDNGECYFY RNVMAKMEIH KEKIDAAARA KEISEVIFHN NDDIKFMRFL SNEYEQMLQE       180
     NAPGKLRFFK RDRERDIAIL SLILGTGLRV SEAASLTISS VNFRTRYIKV VRKGDKKSAI       240
     LATQTALDDV QEYLKVRAVR YKCPEDEDIL FVTNYKGSYA QISVNAIQKF TEKYTRAFDE       300
     KKSPHKLRHT YATNHYNENK DLVLLANQMG HNSMETTSLY TNIDDTKRRA AIERLEQRQL       360
     EENDEIDT                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page