(data stored in ACNUC9435 zone)

EMBL: CP000904.PE91

CP000904.PE91        Location/Qualifiers
FT   CDS             complement(135175..135591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5533"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: lwe:lwe1922 secreted
FT                   thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5533"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46515"
FT                   /db_xref="GOA:A9VV83"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV83"
FT                   /protein_id="ABY46515.1"
FT                   /translation="MIILCFVIIMLIFYMGSTKSSANSSSSFNPISTQKFEELIKEKEN
FT                   VWVYIGRPTCDDCDRFSPVLKEVIKENNKQVYYYNTDEARKENEEKLINHLNKLGVKSV
FT                   PTLIYFKKGEVVKTVVGYQDKASVEKLLKDYESR"
     MIILCFVIIM LIFYMGSTKS SANSSSSFNP ISTQKFEELI KEKENVWVYI GRPTCDDCDR        60
     FSPVLKEVIK ENNKQVYYYN TDEARKENEE KLINHLNKLG VKSVPTLIYF KKGEVVKTVV       120
     GYQDKASVEK LLKDYESR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page