(data stored in ACNUC9435 zone)

EMBL: CP000904.PE92

CP000904.PE92        Location/Qualifiers
FT   CDS             complement(135777..136523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5534"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46516"
FT                   /db_xref="GOA:A9VV84"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV84"
FT                   /protein_id="ABY46516.1"
FT                   /translation="MLVIKILANKYEIKGEIYVSLMKKFAAVAMASTLFFGWSGSSTFA
FT                   SPNTESVSKNVSVNQNKDMKSTFKKMNDLANTTKVIQDSQRIQDIKITAENSISSGKVV
FT                   LNHSDAQLDFDNAKYLDISQDNKSYKSITIPIVGDQYNLISNLTVIFDSQDKISNYSET
FT                   LITKSENNKFVITSYSDGELVQNQVTDVDYKSNSEVKKSLDRINAQAINVDAPQYSMGA
FT                   VAACIAAVATMGAGSIAGVIACFNKL"
     MLVIKILANK YEIKGEIYVS LMKKFAAVAM ASTLFFGWSG SSTFASPNTE SVSKNVSVNQ        60
     NKDMKSTFKK MNDLANTTKV IQDSQRIQDI KITAENSISS GKVVLNHSDA QLDFDNAKYL       120
     DISQDNKSYK SITIPIVGDQ YNLISNLTVI FDSQDKISNY SETLITKSEN NKFVITSYSD       180
     GELVQNQVTD VDYKSNSEVK KSLDRINAQA INVDAPQYSM GAVAACIAAV ATMGAGSIAG       240
     VIACFNKL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page