(data stored in ACNUC9435 zone)

EMBL: CP000904.PE93

CP000904.PE93        Location/Qualifiers
FT   CDS             complement(136527..136769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5535"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46517"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV85"
FT                   /protein_id="ABY46517.1"
FT                   /translation="MLAGHLDANGEPQAFKKSSATFEEARSIRCESSKPNWEEGDSGYL
FT                   KTKEGIQPVVVGKTTTQKTVLHIIGANKFVELTPI"
     MLAGHLDANG EPQAFKKSSA TFEEARSIRC ESSKPNWEEG DSGYLKTKEG IQPVVVGKTT        60
     TQKTVLHIIG ANKFVELTPI                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page