(data stored in ACNUC9435 zone)

EMBL: CP000904.PE96

CP000904.PE96        Location/Qualifiers
FT   CDS             complement(137680..139626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5538"
FT                   /product="Delta endotoxin central region subgroup 1"
FT                   /note="PFAM: delta endotoxin domain protein; Delta
FT                   endotoxin central region subgroup 1; KEGG: reu:Reut_A0376
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5538"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46520"
FT                   /db_xref="GOA:A9VV88"
FT                   /db_xref="InterPro:IPR001178"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036399"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="InterPro:IPR038979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV88"
FT                   /protein_id="ABY46520.1"
FT                   /translation="MNSNNKTNPNVIGTSSDQSLLTNSVKKTLANDQSNPLQHRDSNDC
FT                   LSVSEGNRDSLNHDVFISAPGLVDTTANITSAILSALGVPMLGTVVKLYSKLFGFLWGS
FT                   TPGQDPWKELMDRVEVLIDQKLTEYARSKALAELEGLQNVMKSYVDALESWQNNSRNSQ
FT                   TRLLVQQRLVVADSQFKQAMPSFAIKDYEVSLLPVYTQAANLHLLLLRDSQIFGKDWGM
FT                   PQHEIDLFYKEHLECIEKYSDHCVEWYHTGLNKLKSSTAKDWIDYNRFRREMTVAVLDI
FT                   VALLPKYDVHMYPMPIHAELTREIYTDPVGSYLPYKGNFKDVMSWYEMTKAYRQPTFQD
FT                   LENLILKPSRFTWLKDLKMYTRKRQNGKYEYYNYWVGHQLEKALIGEKYVRETTISGEI
FT                   TSEEDTFTFEDYDIHRVLCNYIGRYDNSLVGVNQVEFHYLDNNTPRKKEYKKDIRVTNQ
FT                   SQKIIDSEEELLSHRLSYVESFDLYWNHKNEKGGTIPVFGWTHHSVAPKNIIYEDKITV
FT                   ISATKASGYFTSEVIQGPGYSGGGLIKGSKSMGNIPLTPPRDAHNKNYRLRIRYAADSD
FT                   DLLKMTFTSGIGPAKYQTPYQATMKKGDSFKYNSFQYVEKVVTISSSINGINFSAGSGF
FT                   YLDKVEFIPVNEN"
     MNSNNKTNPN VIGTSSDQSL LTNSVKKTLA NDQSNPLQHR DSNDCLSVSE GNRDSLNHDV        60
     FISAPGLVDT TANITSAILS ALGVPMLGTV VKLYSKLFGF LWGSTPGQDP WKELMDRVEV       120
     LIDQKLTEYA RSKALAELEG LQNVMKSYVD ALESWQNNSR NSQTRLLVQQ RLVVADSQFK       180
     QAMPSFAIKD YEVSLLPVYT QAANLHLLLL RDSQIFGKDW GMPQHEIDLF YKEHLECIEK       240
     YSDHCVEWYH TGLNKLKSST AKDWIDYNRF RREMTVAVLD IVALLPKYDV HMYPMPIHAE       300
     LTREIYTDPV GSYLPYKGNF KDVMSWYEMT KAYRQPTFQD LENLILKPSR FTWLKDLKMY       360
     TRKRQNGKYE YYNYWVGHQL EKALIGEKYV RETTISGEIT SEEDTFTFED YDIHRVLCNY       420
     IGRYDNSLVG VNQVEFHYLD NNTPRKKEYK KDIRVTNQSQ KIIDSEEELL SHRLSYVESF       480
     DLYWNHKNEK GGTIPVFGWT HHSVAPKNII YEDKITVISA TKASGYFTSE VIQGPGYSGG       540
     GLIKGSKSMG NIPLTPPRDA HNKNYRLRIR YAADSDDLLK MTFTSGIGPA KYQTPYQATM       600
     KKGDSFKYNS FQYVEKVVTI SSSINGINFS AGSGFYLDKV EFIPVNEN                    648
//

If you have problems or comments...

PBIL Back to PBIL home page