(data stored in ACNUC9435 zone)

EMBL: CP000904.PE97

CP000904.PE97        Location/Qualifiers
FT   CDS             complement(139780..141753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5539"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rme:Rmet_5415 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5539"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46521"
FT                   /db_xref="GOA:A9VV89"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV89"
FT                   /protein_id="ABY46521.1"
FT                   /translation="MKITQDPKDATNCTTLFNKQVAEDLNINSETEYALAIKNLVEPCE
FT                   ELVIMEDNKIIWSQKAYQFLEKDEWSSTVNPSLWCNGKNNHVSGLFKVTEEIYQVRGFD
FT                   MANMTMVLTPQKTWVMLDTLMSTECTIAALNFADTYFTKNNLPKLIGNIRAIIMSHSHV
FT                   DHFGGVNGIFTYEEQNPDIPIYAPKGFTEHAVSENIYAGNAMARRAAYQYGSFLDAGKK
FT                   GSISIGIGQTQSKGTISFRLPTHEITENQSIVIDDLKLTFQLTPGAEAPAEMNTHFPKY
FT                   RALWLAENCSGTLHNLYTLRGAQVRDGNAWGKYLLESISLFADETDVTFQAHNWPHWNT
FT                   DDSPNMVREHITVTAAAYKFINDQTLLYINQGYTSTEIADKIQLPTDLAKYWYIRPYYG
FT                   TPKHNAKAVYQKYMGWYDANPANLDPLPNVKRAEKLIDYMGGSDAVIEKSLIDFENGNY
FT                   QFVADIMSTLVFADPNNQKARFLAADALEQLGYQSESGIWRNAYLSGAYELRNGTVTDP
FT                   TKYVSGAEITEYMTGEMILDYLGILIDGDRCSHFSLEFNLIISDDIDLTEGSSEYHMRE
FT                   YILKLYQGTVLYFKDTSSSELPTVTMTRQQLLSLTAGSTPEKAKEIAESISDDPKVIDA
FT                   LVNFMSYITQLSEYRHFNIIEP"
     MKITQDPKDA TNCTTLFNKQ VAEDLNINSE TEYALAIKNL VEPCEELVIM EDNKIIWSQK        60
     AYQFLEKDEW SSTVNPSLWC NGKNNHVSGL FKVTEEIYQV RGFDMANMTM VLTPQKTWVM       120
     LDTLMSTECT IAALNFADTY FTKNNLPKLI GNIRAIIMSH SHVDHFGGVN GIFTYEEQNP       180
     DIPIYAPKGF TEHAVSENIY AGNAMARRAA YQYGSFLDAG KKGSISIGIG QTQSKGTISF       240
     RLPTHEITEN QSIVIDDLKL TFQLTPGAEA PAEMNTHFPK YRALWLAENC SGTLHNLYTL       300
     RGAQVRDGNA WGKYLLESIS LFADETDVTF QAHNWPHWNT DDSPNMVREH ITVTAAAYKF       360
     INDQTLLYIN QGYTSTEIAD KIQLPTDLAK YWYIRPYYGT PKHNAKAVYQ KYMGWYDANP       420
     ANLDPLPNVK RAEKLIDYMG GSDAVIEKSL IDFENGNYQF VADIMSTLVF ADPNNQKARF       480
     LAADALEQLG YQSESGIWRN AYLSGAYELR NGTVTDPTKY VSGAEITEYM TGEMILDYLG       540
     ILIDGDRCSH FSLEFNLIIS DDIDLTEGSS EYHMREYILK LYQGTVLYFK DTSSSELPTV       600
     TMTRQQLLSL TAGSTPEKAK EIAESISDDP KVIDALVNFM SYITQLSEYR HFNIIEP          657
//

If you have problems or comments...

PBIL Back to PBIL home page