(data stored in ACNUC9435 zone)

EMBL: CP000904.PE98

CP000904.PE98        Location/Qualifiers
FT   CDS             141904..142812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: ssp:SSP2166
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5540"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46522"
FT                   /db_xref="GOA:A9VV90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV90"
FT                   /protein_id="ABY46522.1"
FT                   /translation="MNIEQLKLIVTLSEERKLSRVAQKLNLTPSAVCQGIKNLEKELHT
FT                   TLFNRSKNGTYPTTEGLHVIKKAYEALKTIDEIVEYTTEKKDYPKLNMKIAIVPGVIPP
FT                   LVEAINELKMEFPFVEMEIIQGKTQHVLTSLQMGQVDFGLIMHSDNIQSKSIPYNIKKV
FT                   CNGEFHIAMSRNSKLALYNQIDYETLIKEPLALYQDEHILDYVRHIEKETGEYSNTLFV
FT                   TNNSNSIIYAVKNNFAITISPQFTFNNEYRNFYNDIKQVPIKVDENRQPFALWFVSSKR
FT                   TDSTEITDTFFQLIHHYVNAL"
     MNIEQLKLIV TLSEERKLSR VAQKLNLTPS AVCQGIKNLE KELHTTLFNR SKNGTYPTTE        60
     GLHVIKKAYE ALKTIDEIVE YTTEKKDYPK LNMKIAIVPG VIPPLVEAIN ELKMEFPFVE       120
     MEIIQGKTQH VLTSLQMGQV DFGLIMHSDN IQSKSIPYNI KKVCNGEFHI AMSRNSKLAL       180
     YNQIDYETLI KEPLALYQDE HILDYVRHIE KETGEYSNTL FVTNNSNSII YAVKNNFAIT       240
     ISPQFTFNNE YRNFYNDIKQ VPIKVDENRQ PFALWFVSSK RTDSTEITDT FFQLIHHYVN       300
     AL                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page