(data stored in ACNUC9435 zone)

EMBL: CP000904.PE99

CP000904.PE99        Location/Qualifiers
FT   CDS             complement(144065..145450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_2868 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5541"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46523"
FT                   /db_xref="GOA:A9VV91"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV91"
FT                   /protein_id="ABY46523.1"
FT                   /translation="MYFIKKYHHFLITEYKVIIITGVLIFTKLIIVGRELNSMDILITI
FT                   LMFASISLLVYSLIQKIRKKPAIIWLKIAGISFGLALIISGFSVGVRGGFAAITFIIGA
FT                   CATVKLILQFVKKQSGKLKTFIVVLIAFTTYTILDNVIPYSTSVESSDGNVTSQKKPAV
FT                   DAGKVDAKEESREPTHKQYSTEEIKSLFTIGMSIKEFEEKKEDSKLKVRNYNNYDPAGL
FT                   YTFDTKDGQIVVVVLNAKEVIKVETLTDEASLGNFIKDEENRMNEEKRVAKEEADRKLK
FT                   ESYENNKQKLEGSGDSVTNKVNLKSGLAFFDFNNAGSRNFIIHLKDSSGKDVGLLVNTI
FT                   GSYKGKVSATIPASGEYYLEVKSSGDWNVAITQETPLVSESVPGTINGHGDDVVFINIP
FT                   SGNHIVKLKHTGSRNFIIKVNDQNLLVNKIGSYEGSSSHVFKDSGMYSFGVKADGDWSI
FT                   TIE"
     MYFIKKYHHF LITEYKVIII TGVLIFTKLI IVGRELNSMD ILITILMFAS ISLLVYSLIQ        60
     KIRKKPAIIW LKIAGISFGL ALIISGFSVG VRGGFAAITF IIGACATVKL ILQFVKKQSG       120
     KLKTFIVVLI AFTTYTILDN VIPYSTSVES SDGNVTSQKK PAVDAGKVDA KEESREPTHK       180
     QYSTEEIKSL FTIGMSIKEF EEKKEDSKLK VRNYNNYDPA GLYTFDTKDG QIVVVVLNAK       240
     EVIKVETLTD EASLGNFIKD EENRMNEEKR VAKEEADRKL KESYENNKQK LEGSGDSVTN       300
     KVNLKSGLAF FDFNNAGSRN FIIHLKDSSG KDVGLLVNTI GSYKGKVSAT IPASGEYYLE       360
     VKSSGDWNVA ITQETPLVSE SVPGTINGHG DDVVFINIPS GNHIVKLKHT GSRNFIIKVN       420
     DQNLLVNKIG SYEGSSSHVF KDSGMYSFGV KADGDWSITI E                           461
//

If you have problems or comments...

PBIL Back to PBIL home page