(data stored in ACNUC7421 zone)

EMBL: CP000947.PE1

CP000947.PE1         Location/Qualifiers
FT   CDS             279..1646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0136 chromosomal replication initiator
FT                   protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30707"
FT                   /db_xref="GOA:B0UUL8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUL8"
FT                   /protein_id="ACA30707.1"
FT                   /translation="MDKMSSTVSTLWRDCLSQLQDQVSSNDFTTWLRPLQDDVSESNMI
FT                   LYAPNCFIKGWVENHYLTQITKLAQQLLNNDQFMVKIQDGIKPTEKTTTNVEQKTQNEN
FT                   CHNEITSQQNYRSYLNKNHVFDNFVEGKSNQLARAVAQKVAKNPGEQSANPLFLYGGTG
FT                   LGKTHLLHAVGNGILANNPHAQVVYMHAERFMQSYVKALKSDRMDSFKRFYRTVDALLI
FT                   DDIQFFAGKDGTQEEFFHIFNSLFERGRQIILTSDRYPKEIEKIEDRLKSRFGWGISVA
FT                   IEPPELETRVAILLKKAEEKNMVLPEEVAMFIGGKLRTNVRELEGALNRVHAHAEFTGK
FT                   AITIDFVRETLKDMLALQDKLVTIENIQKIVADYYRIKISDLKSKRRSRNITRPRQLAM
FT                   ALAKELTNRSLPEIGRNFGDRDHTTVLHACKAIAKLREEDNGIQEDWSNLIRTLSV"
     MDKMSSTVST LWRDCLSQLQ DQVSSNDFTT WLRPLQDDVS ESNMILYAPN CFIKGWVENH        60
     YLTQITKLAQ QLLNNDQFMV KIQDGIKPTE KTTTNVEQKT QNENCHNEIT SQQNYRSYLN       120
     KNHVFDNFVE GKSNQLARAV AQKVAKNPGE QSANPLFLYG GTGLGKTHLL HAVGNGILAN       180
     NPHAQVVYMH AERFMQSYVK ALKSDRMDSF KRFYRTVDAL LIDDIQFFAG KDGTQEEFFH       240
     IFNSLFERGR QIILTSDRYP KEIEKIEDRL KSRFGWGISV AIEPPELETR VAILLKKAEE       300
     KNMVLPEEVA MFIGGKLRTN VRELEGALNR VHAHAEFTGK AITIDFVRET LKDMLALQDK       360
     LVTIENIQKI VADYYRIKIS DLKSKRRSRN ITRPRQLAMA LAKELTNRSL PEIGRNFGDR       420
     DHTTVLHACK AIAKLREEDN GIQEDWSNLI RTLSV                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page