(data stored in ACNUC7421 zone)

EMBL: CP000947.PE10

CP000947.PE10        Location/Qualifiers
FT   CDS             8210..8446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0010"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: hso:HS_0145 50S
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30708"
FT                   /db_xref="GOA:B0UUW8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW8"
FT                   /protein_id="ACA30708.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESEKR
FT                   FVTLRLTAKGMRIIDKKGIDAVLAEIRARGEKI"
     MSRVCQVTGK RPAVGNNRSH AMNATRRRFL PNLHTHRFWV ESEKRFVTLR LTAKGMRIID        60
     KKGIDAVLAE IRARGEKI                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page