(data stored in ACNUC7421 zone)

EMBL: CP000947.PE100

CP000947.PE100       Location/Qualifiers
FT   CDS             109076..110608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0100"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   hso:HS_0232 NAD(P)(+) transhydrogenase, alpha subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30709"
FT                   /db_xref="GOA:B0UV58"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV58"
FT                   /protein_id="ACA30709.1"
FT                   /translation="MLIGVPRELLDNESRVAATPKTVQQILKLGFEVIVENNAGFNASF
FT                   EDQAFVNAGAKIGSAQDIWNADIIFKVNAPTDAEIAQIKEGATLISFIWPAQNSELMAK
FT                   LSSKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAAHEFGSFFTGQITAAGKV
FT                   PPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEVKEQVKSMGADFLEIDFQEEGGS
FT                   GDGYAKVMSEEFNRRAMALYAEQAKEVDIIITTAAIPGKPAPRLITKEMVDSMKPGSVI
FT                   VDLAALTGGNCDYTQAGEIVVTENQVKVIGYTDFPSRLPTQSSQLYGTNLVNLLKLLCK
FT                   EKDGNIHIDFEDVVLRGVTVIRDGEVTWPAPPIQVSAQTQQKITAPVVDKKEKTPINPK
FT                   VKYGVMALAGAAFLWLGSVMPAAFLSHFTVFVLACVVGYYVVWNVSHALHTPLMAVTNA
FT                   ISGIIIVGALLQIAQGNFFISLLAFIAILVAAINIFGGFKVTQRMLAMFRKG"
     MLIGVPRELL DNESRVAATP KTVQQILKLG FEVIVENNAG FNASFEDQAF VNAGAKIGSA        60
     QDIWNADIIF KVNAPTDAEI AQIKEGATLI SFIWPAQNSE LMAKLSSKKI NVLAMDAVPR       120
     ISRAQALDAL SSMANISGYR AVIEAAHEFG SFFTGQITAA GKVPPAKVLV IGAGVAGLAA       180
     IGAANSLGAI VRAFDSRPEV KEQVKSMGAD FLEIDFQEEG GSGDGYAKVM SEEFNRRAMA       240
     LYAEQAKEVD IIITTAAIPG KPAPRLITKE MVDSMKPGSV IVDLAALTGG NCDYTQAGEI       300
     VVTENQVKVI GYTDFPSRLP TQSSQLYGTN LVNLLKLLCK EKDGNIHIDF EDVVLRGVTV       360
     IRDGEVTWPA PPIQVSAQTQ QKITAPVVDK KEKTPINPKV KYGVMALAGA AFLWLGSVMP       420
     AAFLSHFTVF VLACVVGYYV VWNVSHALHT PLMAVTNAIS GIIIVGALLQ IAQGNFFISL       480
     LAFIAILVAA INIFGGFKVT QRMLAMFRKG                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page