(data stored in ACNUC7421 zone)

EMBL: CP000947.PE101

CP000947.PE101       Location/Qualifiers
FT   CDS             110621..112081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0101"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   hso:HS_0233 NAD(P)(+) transhydrogenase, beta subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30720"
FT                   /db_xref="GOA:B0UV59"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV59"
FT                   /protein_id="ACA30720.1"
FT                   /translation="MSEGLVQAAYIVAALLFIMSLAGLSKHETAKAGCWYGIVGMAIAL
FT                   VATIFGPYSQGLFWIIIAMAVGAVIGIQRAMKVEMTEMPELVAILHSFVGLAAVLVGFN
FT                   SFGLHETAQFLVPEGVEYVTDAAQALLAQQKADFVAEQSVLATIHNVEVFLGIFIGAVT
FT                   FTGSIVAFGKLRGIINSKALMLPHRHKLNLAALIISALLMVAFLNSPDNIFPVLLMTAI
FT                   ALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLNNDLLIVTGALVGSSGAILS
FT                   YIMCKAMNRSFISVIAGGFGNDVVASSEAEQGEHRETTAEEVAEMLKNASSVIITPGYG
FT                   MAVAQAQYPVAEITAKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEI
FT                   NEDFADTDVVLVIGANDTVNPAAMDDPNSPIAGMPVLEVWKAANVVVFKRSMAVGYAGV
FT                   QNPLFFKENTQMLFGDAKERVEDILKAL"
     MSEGLVQAAY IVAALLFIMS LAGLSKHETA KAGCWYGIVG MAIALVATIF GPYSQGLFWI        60
     IIAMAVGAVI GIQRAMKVEM TEMPELVAIL HSFVGLAAVL VGFNSFGLHE TAQFLVPEGV       120
     EYVTDAAQAL LAQQKADFVA EQSVLATIHN VEVFLGIFIG AVTFTGSIVA FGKLRGIINS       180
     KALMLPHRHK LNLAALIISA LLMVAFLNSP DNIFPVLLMT AIALAFGWHL VASIGGADMP       240
     VVVSMLNSYS GWAAAAAGFM LNNDLLIVTG ALVGSSGAIL SYIMCKAMNR SFISVIAGGF       300
     GNDVVASSEA EQGEHRETTA EEVAEMLKNA SSVIITPGYG MAVAQAQYPV AEITAKLRER       360
     GVNVRFGIHP VAGRLPGHMN VLLAEAKVPY DVVLEMDEIN EDFADTDVVL VIGANDTVNP       420
     AAMDDPNSPI AGMPVLEVWK AANVVVFKRS MAVGYAGVQN PLFFKENTQM LFGDAKERVE       480
     DILKAL                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page