(data stored in ACNUC7421 zone)

EMBL: CP000947.PE103

CP000947.PE103       Location/Qualifiers
FT   CDS             complement(114180..115190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0103"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pmu:PM1040
FT                   galactoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30742"
FT                   /db_xref="GOA:B0UV61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV61"
FT                   /protein_id="ACA30742.1"
FT                   /translation="MSALKQNKSLDFLKQNAIYFVLLILLGIIIMQDSSFLSLRNFSNI
FT                   LTQSSVRLIIALGVAGLLVTQGTDLSAGRQVGLAAVISATLLQAMDNINRVFPELGEIP
FT                   IPVVIIVVCVIGAIIGLVNGVVIAFLNVTPFIATMGTMIIVYGINSLYYDAVGSSPIAG
FT                   FNESFSTFAQGFFRIGSFKLSYITIYAALASFFVWVLWNKTRFGKNIFAIGGNPEAAKV
FT                   SGVNVTRNLVVIYMIAGIFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFAG
FT                   GVGTVLGVVTGVLIFTVINYGLTYIGVNPYWQYIIKGSIIIFAVAIDSLKYAKKK"
     MSALKQNKSL DFLKQNAIYF VLLILLGIII MQDSSFLSLR NFSNILTQSS VRLIIALGVA        60
     GLLVTQGTDL SAGRQVGLAA VISATLLQAM DNINRVFPEL GEIPIPVVII VVCVIGAIIG       120
     LVNGVVIAFL NVTPFIATMG TMIIVYGINS LYYDAVGSSP IAGFNESFST FAQGFFRIGS       180
     FKLSYITIYA ALASFFVWVL WNKTRFGKNI FAIGGNPEAA KVSGVNVTRN LVVIYMIAGI       240
     FYAFGGMLEA GRIGSATNNL GFMYELDAIA ACVVGGVSFA GGVGTVLGVV TGVLIFTVIN       300
     YGLTYIGVNP YWQYIIKGSI IIFAVAIDSL KYAKKK                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page