(data stored in ACNUC7421 zone)

EMBL: CP000947.PE105

CP000947.PE105       Location/Qualifiers
FT   CDS             complement(116780..117766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0105"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: pmu:PM1038 d-galactose
FT                   binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30764"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV63"
FT                   /protein_id="ACA30764.1"
FT                   /translation="MKKTILSAVTLAVGFSAISAQSADRIGVTIYKYDDNFMALMRQEI
FT                   DKEAKAVGGLELLMNDSQNAQSVQNDQVDVLISKGIKTLAINLVDPAAAPTVIKKAKSE
FT                   DIPVIFFNKDPGAKAIGSYNHAYYVGTDPKESGLIQGNLIAKHWKANPAYDLNKDGKIQ
FT                   YVLLKGEPGHPDAEARTKYVIEALNAQGIQSEQLFIDTGMWDAAMAKDKVDAWLSSSKA
FT                   NEIEVIISNNDGMAMGALEATKAHGKKLPIFGVDALPEVLQLIKKGEMAGTVLNDGVNQ
FT                   GKAVVQLAKNLAQGKPATEGTNWKLEKRVVRIPYVGIDKDNLNEFLK"
     MKKTILSAVT LAVGFSAISA QSADRIGVTI YKYDDNFMAL MRQEIDKEAK AVGGLELLMN        60
     DSQNAQSVQN DQVDVLISKG IKTLAINLVD PAAAPTVIKK AKSEDIPVIF FNKDPGAKAI       120
     GSYNHAYYVG TDPKESGLIQ GNLIAKHWKA NPAYDLNKDG KIQYVLLKGE PGHPDAEART       180
     KYVIEALNAQ GIQSEQLFID TGMWDAAMAK DKVDAWLSSS KANEIEVIIS NNDGMAMGAL       240
     EATKAHGKKL PIFGVDALPE VLQLIKKGEM AGTVLNDGVN QGKAVVQLAK NLAQGKPATE       300
     GTNWKLEKRV VRIPYVGIDK DNLNEFLK                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page