(data stored in ACNUC7421 zone)

EMBL: CP000947.PE106

CP000947.PE106       Location/Qualifiers
FT   CDS             119165..120214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0108"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   PFAM: galactose-1-phosphate uridyl transferase domain
FT                   protein; KEGG: pmu:PM1036 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30795"
FT                   /db_xref="GOA:B0UVG9"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVG9"
FT                   /protein_id="ACA30795.1"
FT                   /translation="MSEMTEFVATEHPHRRYNPLTEQWVLVSPHRAKRPWQGQQEKIAD
FT                   ENKPCYDSACYLCPGNKRITGEQNPNYTKPFVFKNDFSALLEDTPEPLKTDDPLFQSSL
FT                   ARGESRVVCFSPDHSKTLPLLTVEEIFAVVKVWQEQLEELGKKYQWVQIFENKGAVMGC
FT                   SNPHPHGQIWANSFLPNEVARTDKAQRNYFNKQGSVLLMDYQKRERDLQERVVIETEYW
FT                   VAVVPYWAVWPFEILLLPKIHVKRLIDLNETQAKDLALALKIITTKYDNLFETSFPYSM
FT                   GFHFAPFNGEKNEHWQLHAHFYPPLLRSATVRKFMVGYEMLGESQRDLTAEQAAARLRE
FT                   LSDVHYKNK"
     MSEMTEFVAT EHPHRRYNPL TEQWVLVSPH RAKRPWQGQQ EKIADENKPC YDSACYLCPG        60
     NKRITGEQNP NYTKPFVFKN DFSALLEDTP EPLKTDDPLF QSSLARGESR VVCFSPDHSK       120
     TLPLLTVEEI FAVVKVWQEQ LEELGKKYQW VQIFENKGAV MGCSNPHPHG QIWANSFLPN       180
     EVARTDKAQR NYFNKQGSVL LMDYQKRERD LQERVVIETE YWVAVVPYWA VWPFEILLLP       240
     KIHVKRLIDL NETQAKDLAL ALKIITTKYD NLFETSFPYS MGFHFAPFNG EKNEHWQLHA       300
     HFYPPLLRSA TVRKFMVGYE MLGESQRDLT AEQAAARLRE LSDVHYKNK                   349
//

If you have problems or comments...

PBIL Back to PBIL home page