(data stored in ACNUC7421 zone)

EMBL: CP000947.PE107

CP000947.PE107       Location/Qualifiers
FT   CDS             120233..121399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0109"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: msu:MS0648 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30806"
FT                   /db_xref="GOA:B0UVH0"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH0"
FT                   /protein_id="ACA30806.1"
FT                   /translation="MTQQNPKQRAKQLFSEKFNRTSELNVYAPGRVNIIGEHTDYNDGF
FT                   VMPCAINYGTAISGAKRDDHLFCVYAADLQEYDEFDLTRPIEPKMEAKWTGYVRGMVKF
FT                   IQQHCPDFQQGADLVICGNIPLSAGLSSSASLEIAVGKFCQQLADLSLTNIEIALIGQQ
FT                   AENKFVGANCGNMDQLISALGQKDHFLMIDCRSLDIVTIPVPENIVVMIVNSHVKHDLV
FT                   NGEYNIRRRQCEMAAQFFGVKALRDVSVELFKQKEAELTALDPEIAKRAKHVVTENERV
FT                   LQSVQALQQGDLQKLGELMYQSHDSMRDDFEITVPEIDYLVELAQVVIGKNGGARMTGG
FT                   GFGGCIVAIAPQDKVEAVRQIIADNYEKQTGLKEDFYVCTASKGVTIC"
     MTQQNPKQRA KQLFSEKFNR TSELNVYAPG RVNIIGEHTD YNDGFVMPCA INYGTAISGA        60
     KRDDHLFCVY AADLQEYDEF DLTRPIEPKM EAKWTGYVRG MVKFIQQHCP DFQQGADLVI       120
     CGNIPLSAGL SSSASLEIAV GKFCQQLADL SLTNIEIALI GQQAENKFVG ANCGNMDQLI       180
     SALGQKDHFL MIDCRSLDIV TIPVPENIVV MIVNSHVKHD LVNGEYNIRR RQCEMAAQFF       240
     GVKALRDVSV ELFKQKEAEL TALDPEIAKR AKHVVTENER VLQSVQALQQ GDLQKLGELM       300
     YQSHDSMRDD FEITVPEIDY LVELAQVVIG KNGGARMTGG GFGGCIVAIA PQDKVEAVRQ       360
     IIADNYEKQT GLKEDFYVCT ASKGVTIC                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page