(data stored in ACNUC7421 zone)

EMBL: CP000947.PE109

CP000947.PE109       Location/Qualifiers
FT   CDS             122612..123505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0111"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: hso:HS_0237 magnesium
FT                   and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30829"
FT                   /db_xref="GOA:B0UVH2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH2"
FT                   /protein_id="ACA30829.1"
FT                   /translation="MSNDEQINTITENESKKNFFHSLFGRFFQGELKNRQELVDVIRDS
FT                   EQNELIDQNTREMIEGVIEISELRVRDIMIPRSQIIFIENDQDLEACLDVIIASAHSRF
FT                   PVISDERDNIAGILHAKDLLKFFRSNAEQFELQSLLRPAVIVPESKRVDRMLKDFRAER
FT                   FHMALVVDEFGAISGLVTIEDILEQIVGDIEDEFDEEDVADIRQLSRHTYVVRALTDID
FT                   DFNEQFKTNFADEEVDTIGGLIMQAFGYLPKRGEEVVLDNLNFKVTSADSRRIIQVRVT
FT                   VPDEQLTDSKKQNTEE"
     MSNDEQINTI TENESKKNFF HSLFGRFFQG ELKNRQELVD VIRDSEQNEL IDQNTREMIE        60
     GVIEISELRV RDIMIPRSQI IFIENDQDLE ACLDVIIASA HSRFPVISDE RDNIAGILHA       120
     KDLLKFFRSN AEQFELQSLL RPAVIVPESK RVDRMLKDFR AERFHMALVV DEFGAISGLV       180
     TIEDILEQIV GDIEDEFDEE DVADIRQLSR HTYVVRALTD IDDFNEQFKT NFADEEVDTI       240
     GGLIMQAFGY LPKRGEEVVL DNLNFKVTSA DSRRIIQVRV TVPDEQLTDS KKQNTEE          297
//

If you have problems or comments...

PBIL Back to PBIL home page