(data stored in ACNUC7421 zone)

EMBL: CP000947.PE11

CP000947.PE11        Location/Qualifiers
FT   CDS             8458..8628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0011"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: hso:HS_0145a 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30817"
FT                   /db_xref="GOA:B0UUW9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW9"
FT                   /protein_id="ACA30817.1"
FT                   /translation="MAAKGAREKIRLVSTAETGHFYTTTKNKRNMPEKMEIKKFDPVVR
FT                   KHVIYKEAKIK"
     MAAKGAREKI RLVSTAETGH FYTTTKNKRN MPEKMEIKKF DPVVRKHVIY KEAKIK            56
//

If you have problems or comments...

PBIL Back to PBIL home page