(data stored in ACNUC7421 zone)

EMBL: CP000947.PE114

CP000947.PE114       Location/Qualifiers
FT   CDS             complement(128105..128848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0116"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   hso:HS_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30884"
FT                   /db_xref="GOA:B0UVH7"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH7"
FT                   /protein_id="ACA30884.1"
FT                   /translation="MKIDMHRTKLEQKQPHFDAQKRRKKECKNSNTPFVRPKLELPHGH
FT                   NKLLLHSCCAPCSGEVMEAIHASGIDFTIYFYNPNIHPLKEYLIRKEENIRFAEKWGIP
FT                   FIDADYDRQNWFDRAKGMEDEPERGIRCTMCFDMRFEKAAQYAHENGFPVFTSCLGISR
FT                   WKDMNQINGCGHRAAEKYDDVVYWDYNWRKGGGSQRMIEISKRERFYQQEYCGCVYSLR
FT                   DTNKWREANGRQKIEIGKLYYSADK"
     MKIDMHRTKL EQKQPHFDAQ KRRKKECKNS NTPFVRPKLE LPHGHNKLLL HSCCAPCSGE        60
     VMEAIHASGI DFTIYFYNPN IHPLKEYLIR KEENIRFAEK WGIPFIDADY DRQNWFDRAK       120
     GMEDEPERGI RCTMCFDMRF EKAAQYAHEN GFPVFTSCLG ISRWKDMNQI NGCGHRAAEK       180
     YDDVVYWDYN WRKGGGSQRM IEISKRERFY QQEYCGCVYS LRDTNKWREA NGRQKIEIGK       240
     LYYSADK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page