(data stored in ACNUC7421 zone)

EMBL: CP000947.PE116

CP000947.PE116       Location/Qualifiers
FT   CDS             130182..130493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0118"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: hso:HS_0245 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30903"
FT                   /db_xref="GOA:B0UVH9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVH9"
FT                   /protein_id="ACA30903.1"
FT                   /translation="MYAVFQSGGKQHRVSEGHVVRLEKLELATGSTVEFDSVLMIVNGE
FT                   DIKIGTPVVTGAKVVAEVVSQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA"
     MYAVFQSGGK QHRVSEGHVV RLEKLELATG STVEFDSVLM IVNGEDIKIG TPVVTGAKVV        60
     AEVVSQGRGE KVKIVKFRRR KHSRKQQGHR QWFTEVKITG IQA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page