(data stored in ACNUC7421 zone)

EMBL: CP000947.PE117

CP000947.PE117       Location/Qualifiers
FT   CDS             130514..130771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0119"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: hso:HS_0246 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30913"
FT                   /db_xref="GOA:B0UVI0"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVI0"
FT                   /protein_id="ACA30913.1"
FT                   /translation="MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGMGKDHTLFATADGKVKFEVKGEKSRKYVSVVAE"
     MATKKAGGST RNGRDSEAKR LGVKRFGGES VLAGSIIVRQ RGTKFHAGSN VGMGKDHTLF        60
     ATADGKVKFE VKGEKSRKYV SVVAE                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page