(data stored in ACNUC7421 zone)

EMBL: CP000947.PE118

CP000947.PE118       Location/Qualifiers
FT   CDS             130907..131827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0120"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hso:HS_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30923"
FT                   /db_xref="GOA:B0UVI1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI1"
FT                   /protein_id="ACA30923.1"
FT                   /translation="MKQKPLLGFIFALTTAIAWGSLPIALQQVMNAMSMQTIVWFRFMV
FT                   ATVALAILLKLANRLPKLSDLNRYFFGLVILGVIGLSGNFSLFNSSLKFIEPSVTQIFV
FT                   HFSSFAMMFCGVVIFKERLGLHQKIGLVILIIGLILFFNERADQLFDINIYSIGVFLSM
FT                   SASLIWVTYGLAQKLLLRRFNSQQILLMIYTGCAFVFTPFVEIEQLQNLNTFTLICFIY
FT                   CCLNTLIGYGAYAEALNHWDVAKVSVVITLVPLFTILFAHLLNLIYPQYFSAPELNTLS
FT                   YIGAFIVVFGAMTSAIGYKFIKNKI"
     MKQKPLLGFI FALTTAIAWG SLPIALQQVM NAMSMQTIVW FRFMVATVAL AILLKLANRL        60
     PKLSDLNRYF FGLVILGVIG LSGNFSLFNS SLKFIEPSVT QIFVHFSSFA MMFCGVVIFK       120
     ERLGLHQKIG LVILIIGLIL FFNERADQLF DINIYSIGVF LSMSASLIWV TYGLAQKLLL       180
     RRFNSQQILL MIYTGCAFVF TPFVEIEQLQ NLNTFTLICF IYCCLNTLIG YGAYAEALNH       240
     WDVAKVSVVI TLVPLFTILF AHLLNLIYPQ YFSAPELNTL SYIGAFIVVF GAMTSAIGYK       300
     FIKNKI                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page