(data stored in ACNUC7421 zone)

EMBL: CP000947.PE119

CP000947.PE119       Location/Qualifiers
FT   CDS             131837..133015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0121"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; KEGG: hso:HS_0248 GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30934"
FT                   /db_xref="GOA:B0UVI2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVI2"
FT                   /protein_id="ACA30934.1"
FT                   /translation="MKFIDEALIRIEAGDGGNGCVSFRREKFIPKGGPDGGDGGDGGDV
FT                   YLIADENLNTLIDYRFEKSFAAERGENGRSSDCTGRRGKDITLRVPVGTRAIDNDTKEV
FT                   LGDLTKHGTKMLVAKGGYHGLGNARFKSSVNRAPRQKTNGTPGEKRDLQLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVTRVDTSRSFVIADIPGLIEGAS
FT                   EGAGLGVRFLKHLERCHVLIHLVDIAPIDESDPADNIAIIEGELFQYSEKLANKPRWLV
FT                   FNKIDILSDEEATARAKNIMQRLGGEDDYYLISAATGKNVDVLCRDIMDFIEENPRQEQ
FT                   EKIDAQEVKFKWDDYHQEQLSEQVFTEDDQEEDDWDDWSEDDEEGVEIIYKP"
     MKFIDEALIR IEAGDGGNGC VSFRREKFIP KGGPDGGDGG DGGDVYLIAD ENLNTLIDYR        60
     FEKSFAAERG ENGRSSDCTG RRGKDITLRV PVGTRAIDND TKEVLGDLTK HGTKMLVAKG       120
     GYHGLGNARF KSSVNRAPRQ KTNGTPGEKR DLQLELMLLA DVGMLGLPNA GKSTFIRAVS       180
     AAKPKVADYP FTTLVPSLGV TRVDTSRSFV IADIPGLIEG ASEGAGLGVR FLKHLERCHV       240
     LIHLVDIAPI DESDPADNIA IIEGELFQYS EKLANKPRWL VFNKIDILSD EEATARAKNI       300
     MQRLGGEDDY YLISAATGKN VDVLCRDIMD FIEENPRQEQ EKIDAQEVKF KWDDYHQEQL       360
     SEQVFTEDDQ EEDDWDDWSE DDEEGVEIIY KP                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page