(data stored in ACNUC7421 zone)

EMBL: CP000947.PE12

CP000947.PE12        Location/Qualifiers
FT   CDS             8734..9546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0012"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase; zinc finger Fpg domain
FT                   protein; KEGG: hso:HS_0146 DNA-formamidopyrimidine
FT                   glycosylase (formamidopyrimidine-DNA glycosylase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30922"
FT                   /db_xref="GOA:B0UUX0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUX0"
FT                   /protein_id="ACA30922.1"
FT                   /translation="MPELPEVETTLKGVSPYLKGFIIEKIVVRNPKLRWEVSKELSTFK
FT                   HVKILNLTRRAKYLIIHTEQGYIIGHLGMSGSVRIVPHDNPVNKHDHFDIVMNNGKLLR
FT                   YNDARRFGAWLWTNNLSEFHLFFKLGPEPLSETFNSTYLFKKSRQKSTALKTFLMDNSV
FT                   VVGVGNIYANEILFLCGLHPQKIAKTLTKKQTEQLVFTIKQVLNEAIEQGGTTLKDFLQ
FT                   PDGRPGYFAQKLLVYGNKDKPCPRCGTKIKSIIIGQRNSFFCPQCQKK"
     MPELPEVETT LKGVSPYLKG FIIEKIVVRN PKLRWEVSKE LSTFKHVKIL NLTRRAKYLI        60
     IHTEQGYIIG HLGMSGSVRI VPHDNPVNKH DHFDIVMNNG KLLRYNDARR FGAWLWTNNL       120
     SEFHLFFKLG PEPLSETFNS TYLFKKSRQK STALKTFLMD NSVVVGVGNI YANEILFLCG       180
     LHPQKIAKTL TKKQTEQLVF TIKQVLNEAI EQGGTTLKDF LQPDGRPGYF AQKLLVYGNK       240
     DKPCPRCGTK IKSIIIGQRN SFFCPQCQKK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page