(data stored in ACNUC7421 zone)

EMBL: CP000947.PE121

CP000947.PE121       Location/Qualifiers
FT   CDS             133949..134407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0123"
FT                   /product="fimbrial subunit"
FT                   /note="KEGG: hso:HS_0250 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30956"
FT                   /db_xref="GOA:B0UVI4"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI4"
FT                   /protein_id="ACA30956.1"
FT                   /translation="MKITYIFSSVKKGFTLIELMIVIAIVAILATIAIPSYQNYTKKAA
FT                   ITELLQASAPYRAEVELCVYNNDAPTNCNAGTNGIQAAINTPKGKVKSVSVQGGAITVT
FT                   GNGNLKDITYTLTPTGDASTGVTWSANCNNKADLFPAGFCSSTSTNSP"
     MKITYIFSSV KKGFTLIELM IVIAIVAILA TIAIPSYQNY TKKAAITELL QASAPYRAEV        60
     ELCVYNNDAP TNCNAGTNGI QAAINTPKGK VKSVSVQGGA ITVTGNGNLK DITYTLTPTG       120
     DASTGVTWSA NCNNKADLFP AGFCSSTSTN SP                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page