(data stored in ACNUC7421 zone)

EMBL: CP000947.PE122

CP000947.PE122       Location/Qualifiers
FT   CDS             134553..135290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0124"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0251 arginine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30967"
FT                   /db_xref="GOA:B0UVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI5"
FT                   /protein_id="ACA30967.1"
FT                   /translation="MTISVKNLNFFYGASQALFDINLTAEDGDTVVLLGPSGAGKSTLI
FT                   RTLNLLEVPTSGELSIANNKFDLSQDIANPKQMRQLRQDVGMVFQQYNLWPHLTVMENL
FT                   IEAPIKVLGIAKEKAKEQAIELLKRLRLEEFAERFPLHLSGGQQQRVAIARALMMKPQV
FT                   LLFDEPTAALDPEITAQIVSIIQELQEMGITQVIVTHEVAVAKKVATKVVYMEQGRIVE
FT                   MGDSSCFEQPSTEQFKQYLSHSH"
     MTISVKNLNF FYGASQALFD INLTAEDGDT VVLLGPSGAG KSTLIRTLNL LEVPTSGELS        60
     IANNKFDLSQ DIANPKQMRQ LRQDVGMVFQ QYNLWPHLTV MENLIEAPIK VLGIAKEKAK       120
     EQAIELLKRL RLEEFAERFP LHLSGGQQQR VAIARALMMK PQVLLFDEPT AALDPEITAQ       180
     IVSIIQELQE MGITQVIVTH EVAVAKKVAT KVVYMEQGRI VEMGDSSCFE QPSTEQFKQY       240
     LSHSH                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page